PDB entry 2fzi

View 2fzi on RCSB PDB site
Description: New Insights into DHFR Interactions: Analysis of Pneumocystis carinii and Mouse DHFR Complexes with NADPH and Two Highly Potent Trimethoprim Derivatives
Class: oxidoreductase
Keywords: dihydrofolate reductase, trimethoprim derivatives, ring stacking interactions
Deposited on 2006-02-09, released 2006-12-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.274
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: PNEUMOCYSTIS CARINII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fzia1
  • Heterogens: NAP, DH3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fziA (A:)
    mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
    twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
    fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
    vgtkvphgkinedgfdyefemwtrdl