PDB entry 2fzh

View 2fzh on RCSB PDB site
Description: New Insights into Dihydrofolate Reductase Interactions: Analysis of Pneumocystis carinii and Mouse DHFR Complexes with NADPH and Two Highly Potent Trimethoprim Derivatives
Class: oxidoreductase
Keywords: dihydrofolate reductase, Trimethoprim derivatives, ring stacking interactions, OXIDOREDUCTASE
Deposited on 2006-02-09, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.246
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Pneumocystis carinii [TaxId:4754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16184 (0-205)
  Domains in SCOPe 2.07: d2fzha_
• Heterogens: NDP, DH1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fzhA (A:)
  mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
  twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
  fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
  vgtkvphgkinedgfdyefemwtrdl