PDB entry 2fze

View 2fze on RCSB PDB site
Description: Crystal structure of the binary complex of human glutathione-dependent formaldehyde dehydrogenase with ADP-ribose
Class: oxidoreductase
Keywords: s-nitrosoglutathione reductase, Adenosyl 5'-diphosphoribose, OXIDOREDUCTASE
Deposited on 2006-02-09, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alcohol dehydrogenase class III chi chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5, ADHX, FDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fzea1, d2fzea2
  • Chain 'B':
    Compound: Alcohol dehydrogenase class III chi chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5, ADHX, FDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fzeb1, d2fzeb2
  • Heterogens: ZN, K, PO4, APR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fzeA (A:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fzeB (B:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki