PDB entry 2fz6

View 2fz6 on RCSB PDB site
Description: Crystal structure of hydrophobin HFBI
Class: surface active protein
Keywords: hydrophobin, beta barrel, pseudo-merohedral twinning, amphiphile, SURFACE ACTIVE PROTEIN
Deposited on 2006-02-09, released 2006-08-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrophobin-1
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2fz6a_
  • Chain 'B':
    Compound: Hydrophobin-1
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2fz6b_
  • Chain 'C':
    Compound: Hydrophobin-1
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2fz6c_
  • Chain 'D':
    Compound: Hydrophobin-1
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2fz6d_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fz6A (A:)
    sngngnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccva
    pvagqallcqtavga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fz6A (A:)
    ngngnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvap
    vagqallcqtav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fz6B (B:)
    sngngnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccva
    pvagqallcqtavga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fz6B (B:)
    vcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvagqa
    llcqtavga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fz6C (C:)
    sngngnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccva
    pvagqallcqtavga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fz6C (C:)
    gnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvag
    qallcqtavga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fz6D (D:)
    sngngnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccva
    pvagqallcqtavga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fz6D (D:)
    nvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvagq
    allcqtavg