PDB entry 2fz5

View 2fz5 on RCSB PDB site
Description: Solution structure of two-electron reduced Megasphaera elsdenii flavodoxin
Class: electron transport
Keywords: alpha/beta doubly-wound topology, non-covalently bound FMN, ELECTRON TRANSPORT
Deposited on 2006-02-09, released 2006-03-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Megasphaera elsdenii [TaxId:907]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fz5a1
  • Heterogens: FNR

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fz5A (A:)
    mveivywsgtgnteamaneieaavkaagadvesvrfedtnvddvaskdvillgcpamgse
    eledsvvepfftdlapklkgkkvglfgsygwgsgewmdawkqrtedtgatvigtaivnem
    pdnapeckelgeaaaka