PDB entry 2fyv

View 2fyv on RCSB PDB site
Description: Golgi alpha-mannosidase II complex with an amino-salacinol carboxylate analog
Class: hydrolase
Keywords: glycosyl hydrolase family 38, hydrolase
Deposited on 2006-02-08, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.162
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative golgi alpha-mannosidase II
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • GB CAA54732
    Domains in SCOPe 2.07: d2fyva1, d2fyva2, d2fyva3
  • Heterogens: NAG, PO4, ZN, W72, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fyvA (A:)
    rsshhhhhhgefddpirpplkvarsprpgqcqdvvqdvpnvdvqmlelydrmsfkdidgg
    vwkqgwnikydplkynahhklkvfvvphshndpgwiqtfeeyyqhdtkhilsnalrhlhd
    npemkfiwaeisyfarfyhdlgenkklqmksivkngqlefvtggwvmpdeanshwrnvll
    qltegqtwlkqfmnvtptaswaidpfghsptmpyilqksgfknmliqrthysvkkelaqq
    rqleflwrqiwdnkgdtalfthmmpfysydiphtcgpdpkvccqfdfkrmgsfglscpwk
    vpprtisdqnvaarsdllvdqwkkkaelyrtnvlliplgddfrfkqntewdvqrvnyerl
    fehinsqahfnvqaqfgtlqeyfdavhqaeragqaefptlsgdfftyadrsdnywsgyyt
    srpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhhdgitgtakt
    hvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfsyftlddsrwpgsgvedsr
    ttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtdlannpveaqvspvwswhh
    dtltktihpqgsttkyriifkarvppmglatyvltisdskpehtsyasnlllrknptslp
    lgqypedvkfgdpreislrvgngptlafseqgllksiqltqdsphvpvhfkflkygvrsh
    gdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglpsvvhqtimrggapeirnlv
    digsldnteivmrlethidsgdifytdlnglqfikrrrldklplqanyypipsgmfieda
    ntrltlltgqplggsslasgeleimqdrrlasdderglgqgvldnkpvlhiyrlvlekvn
    ncvrpsklhpagyltsaahkasqslldpldkfifaenewigaqgqfggdhpsaredldvs
    vmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchllpnvarcerttltflqnl
    ehldgmvapevcpmetaayvsshss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fyvA (A:)
    cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
    ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
    sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
    tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
    iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
    tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
    ragqaefptlsgdfftyadrsdnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdg
    marieerleqarrelslfqhhdgitgtakthvvvdyeqrmqealkacqmvmqqsvyrllt
    kpsiyspdfsfsyftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvd
    fyvsspfvsvtdlannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmgla
    tyvltisdskpehtsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafse
    qgllksiqltqdsphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkg
    klessvsvglpsvvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlng
    lqfikrrrldklplqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrl
    asdderglgqgvldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpld
    kfifaenewigaqgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtp
    eehtqkldvchllpnvarcerttltflqnlehldgmvapevcpmetaayvsshs