PDB entry 2fyq

View 2fyq on RCSB PDB site
Description: Crystal Structure of the Norwalk Virus Protease
Class: viral protein
Keywords: protease, norovirus, Norwalk virus, Calicivirus, VIRAL PROTEIN
Deposited on 2006-02-08, released 2006-07-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymotrypsin-like cysteine proteinase
    Species: Norwalk virus [TaxId:11983]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fyqa_
  • Heterogens: CL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fyqA (A:)
    mahhhhhhddddkapptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssi
    aihqageftqfrfskkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasm
    riqgrlvhgqsgmlltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntv
    vcavqagegetale
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fyqA (A:)
    apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
    skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
    lltipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqagegetale