PDB entry 2fyp

View 2fyp on RCSB PDB site
Description: GRP94 in complex with the novel HSP90 Inhibitor Radester amine
Class: chaperone
Keywords: GRP94, HSP82, HSP90, HTPG, chaperone, ligand, radicicol, geldanamycin, radester, radamide
Deposited on 2006-02-08, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (4-221)
      • cloning artifact (0-3)
    • Uniprot P41148 (226-235)
    Domains in SCOPe 2.08: d2fypa2, d2fypa3
  • Chain 'B':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (4-221)
      • cloning artifact (0-3)
    • Uniprot P41148 (226-235)
    Domains in SCOPe 2.08: d2fypb2, d2fypb3
  • Heterogens: RDE, PG4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fypA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fypA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fypB (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fypB (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn