PDB entry 2fyl

View 2fyl on RCSB PDB site
Description: Haddock model of the complex between double module of LRP, CR56, and first domain of receptor associated protein, RAP-d1.
Class: surface active protein
Keywords: Complex, shift-mapping, haddock, NMR, interface, SURFACE ACTIVE PROTEIN
Deposited on 2006-02-08, released 2006-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-2-macroglobulin receptor-associated protein
  Species: Homo sapiens [TaxId:9606]
  Gene: LRPAP1, A2MRAP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30533 (0-80)
  Domains in SCOPe 2.08: d2fyla1
• Chain 'B':
  Compound: Low-density lipoprotein receptor-related protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: LRP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07954 (0-81)
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fylA (A:)
  geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
  lirnlnvilakygldgkkdar
  

  
  
• Chain 'B':
  No sequence available.