PDB entry 2fyh

View 2fyh on RCSB PDB site
Description: Solution structure of the 2'-5' RNA ligase-like protein from Pyrococcus furiosus
Class: ligase
Keywords: 2'-5' RNA ligase-like protein, HXTX motif, Pyrococcus furiosus, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-02-08, released 2007-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative integral membrane transport protein
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF0027
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U4Q3 (0-183)
      • expression tag (184-189)
    Domains in SCOPe 2.07: d2fyha1, d2fyha2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fyhA (A:)
    mrafiaidvsesvrdalvraqdyigskeakikfverenfhitlkflgeiteeqaeeikki
    lekiakkykkhevnvrgigvfpnpnyvrviwagvendeiikkiakeiddelaklgfkkeg
    nfvahitlgrvkfvkdklglamklkelanedfgsfiveaielkkstltpkgpiyetlarf
    elsehhhhhh