PDB entry 2fyh

View 2fyh on RCSB PDB site
Description: Solution structure of the 2'-5' RNA ligase-like protein from Pyrococcus furiosus
Class: ligase
Keywords: 2'-5' RNA ligase-like protein, HXTX motif, Pyrococcus furiosus, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-02-08, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative integral membrane transport protein
  Species: Pyrococcus furiosus [TaxId:186497]
  Gene: PF0027
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U4Q3 (0-183)
    • expression tag (184-189)
  Domains in SCOPe 2.08: d2fyha1, d2fyha2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fyhA (A:)
  mrafiaidvsesvrdalvraqdyigskeakikfverenfhitlkflgeiteeqaeeikki
  lekiakkykkhevnvrgigvfpnpnyvrviwagvendeiikkiakeiddelaklgfkkeg
  nfvahitlgrvkfvkdklglamklkelanedfgsfiveaielkkstltpkgpiyetlarf
  elsehhhhhh