PDB entry 2fyc

View 2fyc on RCSB PDB site
Description: Crystal structure of the catalytic domain of bovine beta1,4-galactosyltransferase-I in complex with alpha-lactalbumin, Ca and UDP-galactose
Class: transferase
Keywords: lactose synthase, M344H mutation, Ca binding
Deposited on 2006-02-07, released 2006-03-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-04-11, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fyca1
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (225)
      • engineered (227)
    Domains in SCOP 1.75: d2fycb1
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fycc1
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (225)
      • engineered (227)
    Domains in SCOP 1.75: d2fycd1
  • Heterogens: GDU, CA, UDP, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fycA (A:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fycB (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fycB (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fycC (C:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fycD (D:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fycD (D:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps