PDB entry 2fy9

View 2fy9 on RCSB PDB site
Description: Solution Structure of the N-Terminal DNA Recognition Domain of the Bacillus Subtilis Transcription-State Regulator ABH
Class: transcription
Keywords: n-terminal DNA-binding domain, transition state regulator, transcription
Deposited on 2006-02-07, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative transition state regulator abh
  Species: Bacillus subtilis [TaxId:1423]
  Gene: abh
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39758 (0-53)
  Domains in SCOPe 2.08: d2fy9a1
• Chain 'B':
  Compound: Putative transition state regulator abh
  Species: Bacillus subtilis [TaxId:1423]
  Gene: abh
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39758 (0-53)
  Domains in SCOPe 2.08: d2fy9b_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fy9A (A:)
  mksigvvrkvdelgrivmpielrraldiaikdsieffvdgdkiilkkykphgvc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fy9B (B:)
  mksigvvrkvdelgrivmpielrraldiaikdsieffvdgdkiilkkykphgvc