PDB entry 2fy5

View 2fy5 on RCSB PDB site
Description: Structures of ligand bound human choline acetyltransferase provide insight into regulation of acetylcholine synthesis
Class: transferase
Keywords: two domain, alpha-beta protein, transferase, S-2-(oxopropyl)-coenzyme A
Deposited on 2006-02-07, released 2006-12-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.237
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choline O-acetyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: CHAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28329
      • engineered (224-226)
      • see remark 999 (354)
      • engineered (514-515)
      • engineered (578-579)
    Domains in SCOPe 2.03: d2fy5a1, d2fy5a2
  • Heterogens: SOP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fy5A (A:)
    aaaktpsseesglpklpvpplqqtlatylqcmrhlvseeqfrksqaivqqfgapgglget
    lqqkllerqektanwvseywlndmylnnrlalpvnsspavifarqhfpgtddqlrfaasl
    isgvlsykalldshsiptdcakgqlsgqplcmkqyyglfssyrlpghtqdtlvaqnssim
    pepehvivaccnqffvldvvinfrrlsegdlftqlrkivkmasnaaarlppiglltsdgr
    sewaeartvlvkdstnrdsldmierciclvcldapggvelsdthralqllhgggysknga
    nrwydkslqfvvgrdgtcgvvcehspfdgivlvqctehllkhmtqpelvrspmvplpapr
    rlrwkcspeiqghlassaeklqrivknldfivykfdnygktfikkqkcspdafiqvalql
    afyrlhrrlvptyesasirrfqegrvdnirsatpealafvravtdhkaavpasekllllk
    dairaqtaytvmaitgmaidnhllalrelaramcaalpemfmdetylmsnrfvlstsqvp
    tttemfccygpvvpngygacynpqpetilfcissfhscaatssskfakaveeslidmrdl
    csllppteskpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fy5A (A:)
    sglpklpvpplqqtlatylqcmrhlvseeqfrksqaivqqfgapgglgetlqqkllerqe
    ktanwvseywlndmylnnrlalpvnsspavifarqhfpgtddqlrfaaslisgvlsykal
    ldshsiptdcakgqlsgqplcmkqyyglfssyrlpghtqdtlvmpepehvivaccnqffv
    ldvvinfrrlsegdlftqlrkivkmasnaaarlppiglltsdgrsewaeartvlvkdstn
    rdsldmierciclvcldapggvelsdthralqllhgggysknganrwydkslqfvvgrdg
    tcgvvcehspfdgivlvqctehllkhmplpaprrlrwkcspeiqghlassaeklqrivkn
    ldfivykfdnygktfikkqkcspdafiqvalqlafyrlhrrlvptyesasirrfqegrvd
    nirsatpealafvravtdhkaavpasekllllkdairaqtaytvmaitgmaidnhllalr
    elaramcaalpemfmdetylmsnrfvlstsqvptttemfccygpvvpngygacynpqpet
    ilfcissfhscaatssskfakaveeslidmrdlcsll