PDB entry 2fy4

View 2fy4 on RCSB PDB site
Description: Structures of ligand bound human choline acetyltransferase provide insight into regulation of acetylcholine synthesis
Class: transferase
Keywords: two domain, alpha-beta protein, transferase, coenzyme A
Deposited on 2006-02-07, released 2006-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choline O-acetyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: CHAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28329
      • engineered (224-226)
      • see remark 999 (345-346)
      • see remark 999 (348)
      • see remark 999 (350-352)
      • see remark 999 (354)
      • engineered (514-515)
      • engineered (578-579)
    Domains in SCOPe 2.08: d2fy4a1, d2fy4a2
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fy4A (A:)
    aaaktpsseesglpklpvpplqqtlatylqcmrhlvseeqfrksqaivqqfgapgglget
    lqqkllerqektanwvseywlndmylnnrlalpvnsspavifarqhfpgtddqlrfaasl
    isgvlsykalldshsiptdcakgqlsgqplcmkqyyglfssyrlpghtqdtlvaqnssim
    pepehvivaccnqffvldvvinfrrlsegdlftqlrkivkmasnaaarlppiglltsdgr
    sewaeartvlvkdstnrdsldmierciclvcldapggvelsdthralqllhgggysknga
    nrwydkslqfvvgrdgtcgvvcehspfdgivlvqctehllkhmtqpelvrspmvplpapr
    rlrwkcspeiqghlassaeklqrivknldfivykfdnygktfikkqkcspdafiqvalql
    afyrlhrrlvptyesasirrfqegrvdnirsatpealafvravtdhkaavpasekllllk
    dairaqtaytvmaitgmaidnhllalrelaramcaalpemfmdetylmsnrfvlstsqvp
    tttemfccygpvvpngygacynpqpetilfcissfhscaatssskfakaveeslidmrdl
    csllppteskpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fy4A (A:)
    sglpklpvpplqqtlatylqcmrhlvseeqfrksqaivqqfgapgglgetlqqkllerqe
    ktanwvseywlndmylnnrlalpvnsspavifarqhfpgtddqlrfaaslisgvlsykal
    ldshsiptdcakgqlsgqplcmkqyyglfssyrlpghtqdtlvaqmpepehvivaccnqf
    fvldvvinfrrlsegdlftqlrkivkmasnaaarlppiglltsdgrsewaeartvlvkds
    tnrdsldmierciclvcldapggvelsdthralqllhgggysknganrwydkslqfvvgr
    dgtcgvvcehspfdgivlvqctehllkhmtqpelvrspmvplpaprrlrwkcspeiqghl
    assaeklqrivknldfivykfdnygktfikkqkcspdafiqvalqlafyrlhrrlvptye
    sasirrfqegrvdnirsatpealafvravtdhkaavpasekllllkdairaqtaytvmai
    tgmaidnhllalrelaramcaalpemfmdetylmsnrfvlstsqvptttemfccygpvvp
    ngygacynpqpetilfcissfhscaatssskfakaveeslidmrdlcsl