PDB entry 2fxv

View 2fxv on RCSB PDB site
Description: Bacillus subtilis Xanthine Phosphoribosyltransferase in Complex with Guanosine 5'-monophosphate (GMP)
Class: transferase
Keywords: Type 1 phosphoribosyltransferase, GMP complex, TRANSFERASE
Deposited on 2006-02-06, released 2006-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.211
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine phosphoribosyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xpt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fxva_
  • Chain 'B':
    Compound: Xanthine phosphoribosyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xpt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fxvb_
  • Heterogens: 5GP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fxvA (A:)
    mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
    giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
    liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
    leegkvsfvqevhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fxvA (A:)
    mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
    giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
    liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
    leegkvsfvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fxvB (B:)
    mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
    giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
    liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
    leegkvsfvqevhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fxvB (B:)
    mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
    giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
    liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
    leegkvsfvq