PDB entry 2fxt

View 2fxt on RCSB PDB site
Description: Crystal Structure of Yeast Tim44
Class: protein transport
Keywords: Mitochondrial Translocase, PROTEIN TRANSPORT
Deposited on 2006-02-06, released 2007-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Import inner membrane translocase subunit TIM44
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TIM44
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fxta1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fxtA (A:)
    siqslknklwdesenplivvmrkitnkvggffaetessrvysqfklmdptfsnesftrhl
    reyivpeileayvkgdvkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivs
    akllapqdipvlvvgcraqeinlyrkkktgeiaagdeanilmssyamvftrdpeqiddde
    tegwkilefvrg