PDB entry 2fxt

View 2fxt on RCSB PDB site
Description: Crystal Structure of Yeast Tim44
Class: protein transport
Keywords: Mitochondrial Translocase
Deposited on 2006-02-06, released 2007-02-06
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.316
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Import inner membrane translocase subunit TIM44
    Species: Saccharomyces cerevisiae
    Gene: TIM44
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fxta1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fxtA (A:)
    siqslknklwdesenplivvmrkitnkvggffaetessrvysqfklmdptfsnesftrhl
    reyivpeileayvkgdvkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivs
    akllapqdipvlvvgcraqeinlyrkkktgeiaagdeanilmssyamvftrdpeqiddde
    tegwkilefvrg