PDB entry 2fxq

View 2fxq on RCSB PDB site
Description: Single-stranded DNA-binding protein from Thermus aquaticus
Class: DNA binding protein
Keywords: 5 strand beta-sheet extended loops, DNA BINDING PROTEIN
Deposited on 2006-02-06, released 2006-02-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-strand binding protein
    Species: Thermus aquaticus [TaxId:271]
    Gene: ssb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fxqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fxqA (A:)
    marglnqvfligtltarpdmrytpgglaildlnlagqdaftdesgqerevpwyhrvrllg
    rqaemwgdllekgqlifvegrleyrqwekdgekksevqvraefidplegrgretledarg
    qprlrralnqvilmgnltrdpdlrytpqgtavvrlglavnerrrgqeeerthflevqawr
    elaewaselrkgdgllvigrlvndswtsssgerrfqtrvealrlerptrgpaqaggsrpp
    tvqtggvdidegledfppeedlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fxqA (A:)
    rglnqvfligtltarpdmrytpgglaildlnlagqdaftdesgqerevpwyhrvrllgrq
    aemwgdllekgqlifvegrleyrsevqvraefidplegrrralnqvilmgnltrdpdlry
    tpqgtavvrlglavnerrthflevqawrelaewaselrkgdgllvigrlvndswtsssge
    rrfqtrvealrlerptr