PDB entry 2fxp

View 2fxp on RCSB PDB site
Description: Solution Structure of the SARS-Coronavirus HR2 Domain
Class: viral protein
Keywords: Prefusion Intermediate, Trimer, Coiled-coil, VIRAL PROTEIN
Deposited on 2006-02-06, released 2006-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-05-20, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spike glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59594 (1-54)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fxpa1, d2fxpa2
  • Chain 'B':
    Compound: Spike glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59594 (1-54)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fxpb2, d2fxpb3
  • Chain 'C':
    Compound: Spike glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59594 (1-54)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fxpc2, d2fxpc3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fxpA (A:)
gshtspdvdlgdisginasvvniqkeidrlnevaknlneslidlqelgkyeqyik

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fxpB (B:)
gshtspdvdlgdisginasvvniqkeidrlnevaknlneslidlqelgkyeqyik

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fxpC (C:)
gshtspdvdlgdisginasvvniqkeidrlnevaknlneslidlqelgkyeqyik