PDB entry 2fxf

View 2fxf on RCSB PDB site
Description: Human spermidine/spermine N1-acetyltransferase
Class: transferase
Keywords: acetyltransferase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2006-02-05, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fxfa_
  • Chain 'B':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fxfb_
  • Heterogens: CA, ACT, ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fxfA (A:)
    akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
    ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
    cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fxfA (A:)
    kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
    hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
    ssmhflvaewnepsinfykrrgasdlwrlfkidkeyllkmatee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fxfB (B:)
    akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
    ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
    cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fxfB (B:)
    akfvirpataadcsdilrlikelakyeyqviltekdlledgfgehpfyhclvaevpkehw
    tpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcss
    mhflvaewnepsinfykrrgasdlegwrlfkidkeyllkmatee