PDB entry 2fxb

View 2fxb on RCSB PDB site
Description: structure of (4*fe-4*s) ferredoxin from bacillus $thermoproteolyticus refined at 2.3 angstroms resolution. structural comparisons of bacterial ferredoxins
Deposited on 1990-02-08, released 1991-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2fxb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fxb_ (-)
    pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
    cptdsikvadepfdgdpnkfe