PDB entry 2fx9

View 2fx9 on RCSB PDB site
Description: Crystal structure of hiv-1 neutralizing human fab 4e10 in complex with a thioether-linked peptide encompassing the 4e10 epitope on gp41
Class: immune system
Keywords: immunoglobulin fold, beta-sandwich, antibody-epitope complex, IMMUNE SYSTEM
Deposited on 2006-02-03, released 2006-12-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.236
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FX9 (0-226)
    Domains in SCOPe 2.05: d2fx9h1, d2fx9h2
  • Chain 'I':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FX9 (0-226)
    Domains in SCOPe 2.05: d2fx9i1, d2fx9i2
  • Chain 'L':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FX9 (0-213)
    Domains in SCOPe 2.05: d2fx9l1, d2fx9l2
  • Chain 'M':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FX9 (0-213)
    Domains in SCOPe 2.05: d2fx9m1, d2fx9m2
  • Chain 'P':
    Compound: Fragment of HIV glycoprotein gp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2FX9 (0-13)
  • Chain 'Q':
    Compound: Fragment of HIV glycoprotein gp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2FX9 (0-13)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx9H (H:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx9I (I:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx9L (L:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx9M (M:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.