PDB entry 2fx7

View 2fx7 on RCSB PDB site
Description: Crystal structure of hiv-1 neutralizing human fab 4e10 in complex with a 16-residue peptide encompassing the 4e10 epitope on gp41
Class: immune system
Keywords: immunoglobulin fold, beta-sandwich, antibody-epitope complex, IMMUNE SYSTEM
Deposited on 2006-02-03, released 2006-12-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.202
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FX7 (0-227)
    Domains in SCOPe 2.02: d2fx7h1, d2fx7h2
  • Chain 'L':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FX7 (0-213)
    Domains in SCOPe 2.02: d2fx7l1, d2fx7l2
  • Chain 'P':
    Compound: Fragment of HIV glycoprotein (GP41)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05880 (0-15)
      • engineered (13-15)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx7H (H:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx7L (L:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'P':
    No sequence available.