PDB entry 2fx2

View 2fx2 on RCSB PDB site
Description: comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures
Class: electron transport
Keywords: electron transport
Deposited on 1991-10-17, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fx2a_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fx2A (A:)
    akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai