PDB entry 2fwu

View 2fwu on RCSB PDB site
Description: Second Ca2+ binding domain of the Na,Ca-exchanger (NCX1)
Class: metal transport regulator
Keywords: beta-sandwich, greek key, beta-bulge, Ca2+ binding
Deposited on 2006-02-03, released 2006-04-18
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-18, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sodium/calcium exchanger 1
  Species: Canis familiaris
  Gene: NCX1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23685 (0-156)
  Domains in SCOP 1.73: d2fwua1
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fwuA (A:)
  hagiftfeepvthvsesigimevkvlrtsgargnvivpyktiegtargggedfedtcgel
  efqndeivktisvkviddeeyeknktffleigeprlvemsekkggftiteeyddkqplts
  keeeerriaemgrpilgehtkleviieesyefkstvd