PDB entry 2fwu

View 2fwu on RCSB PDB site
Description: Second Ca2+ binding domain of the Na,Ca-exchanger (NCX1)
Class: metal transport regulator
Keywords: beta-sandwich, greek key, beta-bulge, Ca2+ binding, METAL TRANSPORT REGULATOR
Deposited on 2006-02-03, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sodium/calcium exchanger 1
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: NCX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fwua1
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fwuA (A:)
    hagiftfeepvthvsesigimevkvlrtsgargnvivpyktiegtargggedfedtcgel
    efqndeivktisvkviddeeyeknktffleigeprlvemsekkggftiteeyddkqplts
    keeeerriaemgrpilgehtkleviieesyefkstvd