PDB entry 2fws

View 2fws on RCSB PDB site
Description: First Ca2+ binding domain of the Na,Ca-exchanger (NCX1)
Class: metal transport regulator
Keywords: beta-sandwich, greek key, cis-proline, beta-bulge, Ca2+ binding, METAL TRANSPORT REGULATOR
Deposited on 2006-02-03, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sodium/calcium exchanger 1
  Species: Canis lupus familiaris [TaxId:9615]
  Gene: NCX1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23685 (0-138)
  Domains in SCOPe 2.07: d2fwsa1
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fwsA (A:)
  vskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtvv
  fkpgetqkeirvgiidddifeedenflvhlsnvkvsseasedgileanhvsalaclgsps
  tatvtifdddhagiftfee