PDB entry 2fwm

View 2fwm on RCSB PDB site
Description: Crystal Structure of E. coli EntA, a 2,3-dihydrodihydroxy benzoate dehydrogenase
Class: oxidoreductase
Keywords: enterobactin, Rossmann Fold, chorismate metabolism, short-chain oxidoreductase, tetramer, OXIDOREDUCTASE
Deposited on 2006-02-02, released 2006-06-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: entA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fwmx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2fwmX (X:)
    ghmdfsgknvwvtgagkgigyatalafveagakvtgfdqaftqeqypfatevmdvadaaq
    vaqvcqrllaeterldalvnaagilrmgatdqlskedwqqtfavnvggafnlfqqtmnqf
    rrqrggaivtvasdaahtprigmsaygaskaalkslalsvglelagsgvrcnvvspgstd
    tdmqrtlwvsddaeeqrirgfgeqfklgiplgkiarpqeiantilflasdlashitlqdi
    vvdggstlga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fwmX (X:)
    mdfsgknvwvtgagkgigyatalafveagakvtgfdqaftqeqypfatevmdvadaaqva
    qvcqrllaeterldalvnaagilrmgatdqlskedwqqtfavnvggafnlfqqtmnqfrr
    qrggaivtvasdaahtprigmsaygaskaalkslalsvglelagsgvrcnvvspgstrpq
    eiantilflasdlashitlqdivvdggstlga