PDB entry 2fwk

View 2fwk on RCSB PDB site
Description: Crystal structure of Cryptosporidium parvum U6 snRNA-associated Sm-like protein LSm5
Class: DNA binding protein
Keywords: U6 snRNA-associated Sm-like protein, LSm5, Structural Genomics, Structural Genomics Consortium, SGC, DNA BINDING PROTEIN
Deposited on 2006-02-02, released 2006-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed):
    • GB EAK90645
    Domains in SCOPe 2.08: d2fwka_
  • Chain 'B':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed):
    • GB EAK90645
    Domains in SCOPe 2.08: d2fwkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fwkA (A:)
    sykvnymsetpanksqggsnqkggniilplalidkcignriyvvmkgdkefsgvlrgfde
    yvnmvlddvqeygfkadeedisggnkklkrvmvnrletillsgnnvamlvpggdpdsfnf
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fwkA (A:)
    gniilplalidkcignriyvvmkgdkefsgvlrgfdeyvnmvlddvqeygfrvmvnrlet
    illsgnnvamlvpggdp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fwkB (B:)
    sykvnymsetpanksqggsnqkggniilplalidkcignriyvvmkgdkefsgvlrgfde
    yvnmvlddvqeygfkadeedisggnkklkrvmvnrletillsgnnvamlvpggdpdsfnf
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fwkB (B:)
    iilplalidkcignriyvvmkgdkefsgvlrgfdeyvnmvlddvqeygvmvnrletills
    gnnvamlvpgg