PDB entry 2fwi

View 2fwi on RCSB PDB site
Description: Structure of PurE (N5-carboxyaminoimidazole ribonucleotide mutase) H59D, from the acidophilic bacterium Acetobacter aceti, complexed with 5-aminoimidazole ribonucleotide (AIR)
Class: Lyase
Keywords: acidophile, PurE, purine biosynthesis, Lyase
Deposited on 2006-02-02, released 2006-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.165
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti [TaxId:435]
    Gene: purE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2QJL3
      • engineered (59)
    Domains in SCOPe 2.06: d2fwia_
  • Chain 'B':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti [TaxId:435]
    Gene: purE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2QJL3
      • engineered (59)
    Domains in SCOPe 2.06: d2fwib_
  • Heterogens: AIR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fwiA (A:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsad
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fwiA (A:)
    sapvvgiimgsqsdwetmrhadallteleiphetlivsadrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletwralqtasvpnspi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fwiB (B:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsad
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fwiB (B:)
    sapvvgiimgsqsdwetmrhadallteleiphetlivsadrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletwralqtasvpnspite