PDB entry 2fwh

View 2fwh on RCSB PDB site
Description: atomic resolution crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (reduced form at pH7)
Class: Oxidoreductase
Keywords: DSBD, THIOREDOXIN-LIKE, C-terminal domain, reduced form at pH7, Oxidoreductase
Deposited on 2006-02-02, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.113
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli [TaxId:562]
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fwha_
  • Heterogens: IOD, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fwhA (A:)
    athtaqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvq
    kaladtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfs
    ahlrdrqphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fwhA (A:)
    hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
    qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdr