PDB entry 2fwg

View 2fwg on RCSB PDB site
Description: high resolution crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (photoreduced form)
Class: Oxidoreductase
Keywords: DSBD, THIOREDOXIN-LIKE, C-terminal domain, photoreduced form
Deposited on 2006-02-02, released 2006-06-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.149
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655
      • his tag (128-132)
    Domains in SCOP 1.73: d2fwga1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fwgA (A:)
    athtaqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvq
    kaladtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfs
    ahlrdrqphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fwgA (A:)
    thlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvl
    lqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdhhh
    hh