PDB entry 2fwe

View 2fwe on RCSB PDB site
Description: crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (oxidized form)
Class: Oxidoreductase
Keywords: DSBD, THIOREDOXIN-LIKE, C-terminal domain, oxidized form
Deposited on 2006-02-02, released 2006-06-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.165
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655 (Start-127)
      • his tag (128-130)
    Domains in SCOP 1.73: d2fwea1
  • Heterogens: IOD, NI, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fweA (A:)
athtaqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvq
kaladtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfs
ahlrdrqphhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2fweA (A:)
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrqph
hh