PDB entry 2fw3

View 2fw3 on RCSB PDB site
Description: Crystal structure of rat carnitine palmitoyltransferase 2 in complex with antidiabetic drug ST1326
Class: transferase
Keywords: central six-stranded beta-sheet, TRANSFERASE
Deposited on 2006-02-01, released 2007-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carnitine O-palmitoyltransferase II, mitochondrial
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fw3a1
  • Heterogens: BUI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fw3A (A:)
    mgsshhhhhhssglvprgshmavsgpddylqhsivptmhyqdslprlpipkledtmkryl
    naqkpllddsqfrrtealcknfetgvgkelhahllaqdkqnkhtsyisgpwfdmyltard
    sivlnfnpfmafnpdpkseyndqltratnltvsavrflktlqagllepevfhlnpsksdt
    dafkrlirfvppslswygaylvnaypldmsqyfrlfnstriprpnrdelftdtkarhllv
    lrkghfyvfdvldqdgnivnpleiqahlkyilsdsspvpefpvayltsenrdvwaelrqk
    lifdgneetlkkvdsavfclclddfpmkdlihlshtmlhgdgtnrwfdksfnlivaedgt
    aavhfehswgdgvavlrffnevfrdstqtpaitpqsqpaatnssasvetlsfnlsgalka
    gitaakekfdttvktlsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvat
    yescstaafkhgrtetirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltke
    aamgqgfdrhlyalrylatarglnlpelyldpayqqmnhnilststlnspavslggfapv
    vpdgfgiayavhddwigcnvssysgrnareflhcvqkcledifdalegkaikt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fw3A (A:)
    ddylqhsivptmhyqdslprlpipkledtmkrylnaqkpllddsqfrrtealcknfetgv
    gkelhahllaqdkqnkhtsyisgpwfdmyltardsivlnfnpfmafnpdpkseyndqltr
    atnltvsavrflktlqagllepevfhlnpsksdtdafkrlirfvppslswygaylvnayp
    ldmsqyfrlfnstriprpnrdelftdtkarhllvlrkghfyvfdvldqdgnivnpleiqa
    hlkyilsdsspvpefpvayltsenrdvwaelrqklifdgneetlkkvdsavfclclddfp
    mkdlihlshtmlhgdgtnrwfdksfnlivaedgtaavhfehswgdgvavlrffnevfrds
    tqtpaitpqsqpaatnssasvetlsfnlsgalkagitaakekfdttvktlsidsiqfqrg
    gkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrtetirpasiftkr
    cseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalrylatarglnlp
    elyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddwigcnvssysgr
    nareflhcvqkcledifdalegk