PDB entry 2fvv

View 2fvv on RCSB PDB site
Description: Human Diphosphoinositol polyphosphate phosphohydrolase 1
Class: hydrolase
Keywords: diphosphoinositol polyphosphate phosphohydrolase, NUDIX, inositol polyphosphate metabolism, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2006-01-31, released 2006-03-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.169
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diphosphoinositol polyphosphate phosphohydrolase 1
    Species: HOMO SAPIENS
    Gene: NUDT3, DIPP, DIPP1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fvva1
  • Heterogens: CL, SO4, IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fvvA (A:)
    mhhhhhhssgvdlgtenlyfqsmmklksnqtrtydgdgykkraaclcfrseseeevllvs
    ssrhpdrwivpgggmepeeepsvaavrevceeagvkgtlgrlvgifenqerkhrtyvyvl
    ivtevledwedsvnigrkrewfkiedaikvlqyhkpvqasyfetlrqgysanngtpvvat
    tysvsaqssmsgir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvvA (A:)
    qtrtydgdgykkraaclcfrseseeevllvsssrhpdrwivpgggmepeeepsvaavrev
    ceeagvkgtlgrlvgifenqerkhrtyvyvlivtevledwedsvnigrkrewfkiedaik
    vlqyhkpvqasyfet