PDB entry 2fvt

View 2fvt on RCSB PDB site
Description: NMR Structure of the Rpa2829 protein from Rhodopseudomonas palustris: Northeast Structural Genomics Target RpR43
Class: structural genomics, unknown function
Keywords: MTH938-like fold, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-01-31, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: Rpa2829
    Database cross-references and differences (RAF-indexed):
    • GB CAE28271 (0-126)
      • see remark 999 (27)
      • cloning artifact (127-128)
      • expression tag (129-134)
    Domains in SCOPe 2.07: d2fvta1, d2fvta2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fvtA (A:)
maqrseiphfprtaaidaygkggfyfagmshqgsllflpdavwgwdvtkpeqidryslqr
vfdnanaidtlivgtgadvwiaprqlrealrgvnvvldtmqtgpairtynimigerrrva
aaliavplehhhhhh