PDB entry 2fvs

View 2fvs on RCSB PDB site
Description: A Structural Study of the CA Dinucleotide Step in the Integrase Processing Site of Moloney Murine Leukemia Virus
Class: transferase/DNA
Keywords: LTR, MMLV, integrase
Deposited on 2006-01-31, released 2006-12-12
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.243
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Moloney murine leukemia virus
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fvsa1
  • Chain 'B':
    Compound: 5'-d(*cp*ap*cp*ap*ap*tp*gp*ap*tp*cp*ap*tp*tp*gp*tp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fvsA (A:)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllkegqr
    

  • Chain 'B':
    No sequence available.