PDB entry 2fvp

View 2fvp on RCSB PDB site
Description: A Structural Study of the CA Dinucleotide Step in the Integrase Processing Site of Moloney Murine Leukemia Virus
Class: transferase/DNA
Keywords: LTR, MMLV, integrase
Deposited on 2006-01-31, released 2006-12-12
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.224
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Moloney murine leukemia virus
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fvpa1
  • Chain 'B':
    Compound: 5'-d(*tp*tp*tp*cp*ap*tp*tp*gp*cp*ap*ap*tp*gp*ap*ap*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fvpA (A:)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllkegqr
    

  • Chain 'B':
    No sequence available.