PDB entry 2fvn

View 2fvn on RCSB PDB site
Description: The fibrillar tip complex of the Afa/Dr adhesins from pathogen E. coli displays synergistic binding to 5 1 and v 3 integrins
Class: cell adhesion
Keywords: afaD, afaE, fibrillar, afimbrial, integrin-binding, DAEC, DAF, CEACAM, CELL ADHESION
Deposited on 2006-01-31, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein afaD
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47038 (12-132)
      • cloning artifact (11)
      • cloning artifact (133-152)
    Domains in SCOPe 2.08: d2fvna1, d2fvna2, d2fvna3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fvnA (A:)
    mrgshhhhhhgsaelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgra
    eryvvqskdgrhelrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgey
    rfsvggacvvpqednkqgftpsgttgttkltvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvnA (A:)
    saelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgr
    helrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvp
    qednkqgftpsgttgttkltvt