PDB entry 2fvm

View 2fvm on RCSB PDB site
Description: Crystal structure of dihydropyrimidinase from Saccharomyces kluyveri in complex with the reaction product N-carbamyl-beta-alanine
Class: Hydrolase
Keywords: beta/alpha barrel, beta sandwich, Hydrolase
Deposited on 2006-01-31, released 2006-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropyrimidinase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: pyd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P903 (0-End)
      • modified residue (165)
    Domains in SCOPe 2.07: d2fvma1, d2fvma2
  • Chain 'B':
    Compound: dihydropyrimidinase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: pyd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P903 (0-End)
      • modified residue (165)
    Domains in SCOPe 2.07: d2fvmb1, d2fvmb2
  • Chain 'C':
    Compound: dihydropyrimidinase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: pyd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P903 (0-End)
      • modified residue (165)
    Domains in SCOPe 2.07: d2fvmc1, d2fvmc2
  • Chain 'D':
    Compound: dihydropyrimidinase
    Species: Lachancea kluyveri [TaxId:4934]
    Gene: pyd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P903 (0-540)
      • modified residue (165)
    Domains in SCOPe 2.07: d2fvmd1, d2fvmd2
  • Heterogens: ZN, URP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fvmA (A:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchhhgeves
    ygvgidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcs
    ynyyektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklv
    eiqctnpakvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdyt
    pfegieiknwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    spgddddkhhhhhhhhsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvmA (A:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchgvgidls
    sisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcsynyyekts
    taskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklveiqctnpa
    kvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdytpfegieik
    nwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fvmB (B:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchhhgeves
    ygvgidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcs
    ynyyektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklv
    eiqctnpakvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdyt
    pfegieiknwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    spgddddkhhhhhhhhsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvmB (B:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchgvgidls
    sisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcsynyyekts
    taskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklveiqctnpa
    kvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdytpfegieik
    nwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fvmC (C:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchhhgeves
    ygvgidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcs
    ynyyektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklv
    eiqctnpakvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdyt
    pfegieiknwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    spgddddkhhhhhhhhsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvmC (C:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrcgvgidlss
    isespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcsynyyektst
    askhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklveiqctnpak
    vygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdytpfegieikn
    wprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fvmD (D:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchhhgeves
    ygvgidlssisespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcs
    ynyyektstaskhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklv
    eiqctnpakvygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdyt
    pfegieiknwprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkye
    spgddddkhhhhhhhhsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvmD (D:)
    piydliikngiictasdiyaaeiavnngkvqliaasidpslgsevidaegafitpggida
    hvhvdeplkllgdvvdtmehatrsavaggtttvvafstqdvskkgpsalaesvkldvdey
    seqtlycdyglhlilfqiekpsvearelldvqlqaayndygvssvkmfmtypglqisdyd
    imsamyatrkngfttmlhaengdmvkwmiealeeqgltdayyhgvsrpsivegeatnrai
    tlattmdtpilfvhvsspqaaevikqaqtkglkvyaetcpqyallsdaitrchvgidlss
    isespftnpddrfigskyicsppirpegtqksiwkgmnngtftivgsdhcsynyyektst
    askhrafdpennkngefryipnglpgvctrmpllydygylrgnltsmmklveiqctnpak
    vygmypqkgsilpgvsdadlviwypddskkeynskpklitnklmehncdytpfegieikn
    wprytivkgkivykegeilkenadgkylkrgksfmctpknewvtewrpkyes