PDB entry 2fvh

View 2fvh on RCSB PDB site
Description: Crystal Structure of Rv1848, a Urease Gamma Subunit UreA (Urea amidohydrolase), from Mycobacterium Tuberculosis
Class: hydrolase
Keywords: Protein: UreA homolog, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, hydrolase
Deposited on 2006-01-30, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease gamma subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ureA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fvha_
  • Chain 'B':
    Compound: urease gamma subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ureA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fvhb_
  • Chain 'C':
    Compound: urease gamma subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ureA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fvhc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fvhA (A:)
    mgsshhhhhhssglvpagshmrltpheqerlllsyaaelarrrrarglrlnhpeaiavia
    dhilegardgrtvaelmasgrevlgrddvmegvpemlaevqveatfpdgtklvtvhqpia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvhA (A:)
    rltpheqerlllsyaaelarrrrarglrlnhpeaiaviadhilegardgrtvaelmasgr
    evlgrddvmegvpemlaevqveatfpdgtklvtvhqpia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fvhB (B:)
    mgsshhhhhhssglvpagshmrltpheqerlllsyaaelarrrrarglrlnhpeaiavia
    dhilegardgrtvaelmasgrevlgrddvmegvpemlaevqveatfpdgtklvtvhqpia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvhB (B:)
    rltpheqerlllsyaaelarrrrarglrlnhpeaiaviadhilegardgrtvaelmasgr
    evlgrddvmegvpemlaevqveatfpdgtklvtvhqpia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fvhC (C:)
    mgsshhhhhhssglvpagshmrltpheqerlllsyaaelarrrrarglrlnhpeaiavia
    dhilegardgrtvaelmasgrevlgrddvmegvpemlaevqveatfpdgtklvtvhqpia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvhC (C:)
    rltpheqerlllsyaaelarrrrarglrlnhpeaiaviadhilegardgrtvaelmasgr
    evlgrddvmegvpemlaevqveatfpdgtklvtvhqpia