PDB entry 2fvg

View 2fvg on RCSB PDB site
Description: Crystal structure of Endoglucanase (tm1049) from THERMOTOGA MARITIMA at 2.01 A resolution
Class: hydrolase
Keywords: tm1049, Endoglucanase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2006-01-30, released 2006-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-07, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Thermotoga maritima MSB8
    Gene: tm1049
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0D9 (1-339)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (8-9)
      • modified residue (61)
      • modified residue (274)
    Domains in SCOP 1.73: d2fvga1, d2fvga2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fvgA (A:)
    gmylkelsmmpgvsgdegkvrdfikskieglvdnlytdvlgnlialkrgrdsskkllvsa
    hmdevgfvvskiekdgkvsflpvggvdprilpgkvvqvknlkgvigyrpihlqrdeentp
    prfenlridfgfssadeakkyvsigdyvsfvsdyiekngravgkafddragcsvlidvle
    sgvspaydtyfvftvqeetglrgsavvveqlkptcaivvetttagdnpeleerkwathlg
    dgpaitfyhrgyvipkeifqtivdtaknndipfqmkrrtaggtdagryartaygvpagvi
    stparyihspnsiidlndyentkklikvlveegkivevvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fvgA (A:)
    gmylkelsmmpgvsgdegkvrdfikskieglvdnlytdvlgnlialkrgrdsskkllvsa
    hmdevgfvvskiekdgkvsflpvggvdprilpgkvvqvknlkgvigyrpprfenlridfg
    fssadeakkyvsigdyvsfvsdyiekngravgkafddragcsvlidvlesgvspaydtyf
    vftvqeesavvveqlkptcaivvetttagdnpeleerkwathlgdgpaitfyhrgyvipk
    eifqtivdtaknndipfqmkrrtygvpagvistparyihspnsiidlndyentkklikvl
    veegkivevvs