PDB entry 2fv8

View 2fv8 on RCSB PDB site
Description: The crystal structure of RhoB in the GDP-bound state
Class: signaling protein
Keywords: RHOB, GDP/GTP binding, GTP hydrolysis, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-01-30, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho-related GTP-binding protein RhoB
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOB, ARH6, ARHB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62745 (23-End)
      • cloning artifact (18-22)
    Domains in SCOPe 2.07: d2fv8a1, d2fv8a2
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fv8A (A:)
    mhhhhhhssgvdlgtenlyfqsmirkklvvvgdgacgktcllivfskdefpevyvptvfe
    nyvadievdgkqvelalwdtagqedydrlrplsypdtdvilmcfsvdspdslenipekwv
    pevkhfcpnvpiilvankkdlrsdehvrtelarmkqepvrtddgramavriqaydylecs
    aktkegvrevfetatraalqkrygsqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fv8A (A:)
    yfqsmirkklvvvgdgacgktcllivfskdefpfenyvadievdgkqvelalwdtagqed
    ydrlrplsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdlrsde
    hvrtelarmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalqkrygs