PDB entry 2fv4

View 2fv4 on RCSB PDB site
Description: NMR solution structure of the yeast kinetochore Spc24/Spc25 globular domain
Class: structural protein, protein binding
Keywords: alpha-beta, complex, coiled-coil, STRUCTURAL PROTEIN, PROTEIN BINDING
Deposited on 2006-01-29, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YER018C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fv4a1
  • Chain 'B':
    Compound: Hypothetical 24.6 kDa protein in ILV2-ADE17 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YMR117C, YM9718.16C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fv4b1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fv4A (A:)
gshmaaqsgndaaevalyerllqlrvlpgasdvhdvrfvfgddsrcwievamhgdhvign
shpaldpksratlehvltvqgdlaaflvvardmllasl

    Sequence, based on observed residues (ATOM records): (download) 
    >2fv4A (A:)
ndaaevalyerllqlrvlpgasdvhdvrfvfgddsrcwievamhgdhvignshpaldpks
ratlehvltvqgdlaaflvvardmllasl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2fv4B (B:)
makviepeleeqsavtpeanenilklklyrslgvildlendqvlinrkndgnidilpldn
nlsdfyktkyiwerlgk

    Sequence, based on observed residues (ATOM records): (download) 
    >2fv4B (B:)
nenilklklyrslgvildlendqvlinrkndgnidilpldnnlsdfyktkyiwerlgk