PDB entry 2fv1

View 2fv1 on RCSB PDB site
Description: UGL_D88N/dGlcA-GlcNAc
Class: hydrolase
Keywords: alpha6/alpha6-barrel, HYDROLASE
Deposited on 2006-01-28, released 2006-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.179
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unsaturated glucuronyl hydrolase
    Species: Bacillus sp. [TaxId:84635]
    Gene: ugl
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RC92 (0-376)
      • engineered (87)
    Domains in SCOPe 2.06: d2fv1a_
  • Chain 'B':
    Compound: unsaturated glucuronyl hydrolase
    Species: Bacillus sp. [TaxId:84635]
    Gene: ugl
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RC92 (0-376)
      • engineered (87)
    Domains in SCOPe 2.06: d2fv1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fv1A (A:)
    mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
    eqyregavrtvasfrerldrfenldhhnigflyslsakaqwivekdesarklaldaadvl
    mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
    rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
    dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
    perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
    llrlergvtgywyergr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fv1B (B:)
    mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
    eqyregavrtvasfrerldrfenldhhnigflyslsakaqwivekdesarklaldaadvl
    mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
    rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
    dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
    perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
    llrlergvtgywyergr