PDB entry 2fuz

View 2fuz on RCSB PDB site
Description: UGL hexagonal crystal structure without glycine and DTT molecules
Class: hydrolase
Keywords: alpha6/alpha6-barrel
Deposited on 2006-01-28, released 2006-05-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unsaturated glucuronyl hydrolase
    Species: Bacillus sp.
    Gene: ugl
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fuza1
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fuzA (A:)
    mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
    eqyregavrtvasfrerldrfenldhhdigflyslsakaqwivekdesarklaldaadvl
    mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
    rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
    dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
    perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
    llrlergvtgywyergr