PDB entry 2fus

View 2fus on RCSB PDB site
Description: mutations of fumarase that distinguish between the active site and a nearby dicarboxylic acid binding site
Class: hydrolyase
Keywords: hydrolyase, carbon oxygen lyase, kreb's cycle enzyme, fumarate hydratase
Deposited on 1997-01-09, released 1997-07-23
The last revision prior to the SCOP 1.73 freeze date was dated 1997-07-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.178
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarase c
    Species: Escherichia coli
    Gene: FUMC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05042
      • engineered (128)
    Domains in SCOP 1.73: d2fusa_
  • Chain 'B':
    Compound: fumarase c
    Species: Escherichia coli
    Gene: FUMC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05042 (0-End)
      • engineered (128)
    Domains in SCOP 1.73: d2fusb_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fusA (A:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvnpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fusA (A:)
    vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
    llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
    merkvnpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
    igrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
    rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
    cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
    mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
    iakkahkegltlkaaalalgylseaefdswvrpeqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fusB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvnpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fusB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvnpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepmpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrpm
    vihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaaei
    akkahkegltlkaaalalgylseaefdswvrpeqm