PDB entry 2fur

View 2fur on RCSB PDB site
Description: crystal structure of a putative fmn-binding protein (ta1372) from thermoplasma acidophilum at 1.80 a resolution
Class: fmn-binding protein
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, fmn-binding protein
Deposited on 2006-01-27, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: 10640715
    Database cross-references and differences (RAF-indexed):
    • GB CAC12493 (Start-208)
      • modified residue (27)
      • modified residue (49-50)
      • modified residue (64)
      • see remark 999 (135)
      • modified residue (161)
    Domains in SCOPe 2.07: d2fura1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: 10640715
    Database cross-references and differences (RAF-indexed):
    • GB CAC12493 (Start-208)
      • modified residue (27)
      • modified residue (49-50)
      • modified residue (64)
      • see remark 999 (135)
      • modified residue (161)
    Domains in SCOPe 2.07: d2furb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2furA (A:)
    gmavecikdkvtryperasysdedlvamldrnftctvsfidggipyaipmmlasegktiy
    lhgsmksriygilktgqliaislleingivlakeiknnsinyvsalifgrpyeiddtekk
    ievfrllteklvkgrwdnsikpsyedlngvfvfavkpetfsmkartgpphdtstddiwsg
    vlpiqhtiseagenapeyvkslygkrifi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2furA (A:)
    rasysdedlvamldrnftctvsfidggipyaipmmlasegktiylhgsmksriygilktg
    qliaislleingivlakeiknnsinyvsalifgrpyeiddtekkievfrllteklvkgrw
    dnsikpsyedlngvfvfavkpetfsmkartgpphdtstddiwsgvlpiqhtiseagenap
    eyvkslygkrifi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2furB (B:)
    gmavecikdkvtryperasysdedlvamldrnftctvsfidggipyaipmmlasegktiy
    lhgsmksriygilktgqliaislleingivlakeiknnsinyvsalifgrpyeiddtekk
    ievfrllteklvkgrwdnsikpsyedlngvfvfavkpetfsmkartgpphdtstddiwsg
    vlpiqhtiseagenapeyvkslygkrifi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2furB (B:)
    ysdedlvamldrnftctvsfidggipyaipmmlasegktiylhgsmksriygilktgqli
    aislleingivlakeiknnsinyvsalifgrpyeiddtekkievfrllteklvkgrwdns
    ikpsyedlngvfvfavkpetfsmkartgpphdtstddiwsgvlpiqhtiseagenapeyv
    kslygkrifi