PDB entry 2fup

View 2fup on RCSB PDB site
Description: Crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 A resolution
Class: biosynthetic protein
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, biosynthetic protein
Deposited on 2006-01-27, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.19
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA3352
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: np_252042.1
    Database cross-references and differences (RAF-indexed):
    • GB NP_252042 (1-End)
      • modified residue (1)
      • modified residue (51)
    Domains in SCOPe 2.07: d2fupa1
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fupA (A:)
    gmpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngr
    araeilreagvsldreglaryareradgaellargdelgellercqqanlrngriiranq
    astgsllnilrgqdapslydsrggtasssrqrplsqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fupA (A:)
    mpdsptlldlfaedighanqllqlvdeefqalerrelpvlqqllgakqplmqqlerngra
    raeilreagvsldreglaryareradgaellargdelgellercqqanlrngrianqast
    gsllnilr